RetrogeneDB ID: | retro_cpor_902 | ||
Retrocopylocation | Organism: | Guinea Pig (Cavia porcellus) | |
Coordinates: | scaffold_32:20266472..20266641(-) | ||
Located in intron of: | ENSCPOG00000014878 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PPIA | ||
Ensembl ID: | ENSCPOG00000002632 | ||
Aliases: | None | ||
Description: | Peptidyl-prolyl cis-trans isomerase [Source:UniProtKB/TrEMBL;Acc:H0UZ02] |
Percent Identity: | 67.8 % |
Parental protein coverage: | 54.81 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MVNPTVFFDIAADGEPLGRVSFELYADKVPKTAENFRALS-TGEK-GFGYKGSCFHRII |
MV..TVFFDI..D..PLG..SFEL.AD.VPKTAENF.AL..T.EK..FGYK.SCF..II | |
Retrocopy | MVTSTVFFDITRDSKPLGCFSFELFADIVPKTAENFHALA<TVEK<AFGYKDSCFYTII |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 464 .33 RPM |
SRP017611_kidney | 0 .00 RPM | 448 .59 RPM |
SRP017611_liver | 0 .00 RPM | 277 .27 RPM |
SRP040447_lung | 0 .03 RPM | 585 .22 RPM |
SRP040447_skeletal_muscle | 0 .00 RPM | 191 .42 RPM |