RetrogeneDB ID: | retro_dnov_1432 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_20333:79668..80064(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS27A | ||
Ensembl ID: | ENSDNOG00000004813 | ||
Aliases: | None | ||
Description: | ribosomal protein S27a [Source:HGNC Symbol;Acc:10417] |
Percent Identity: | 87.97 % |
Parental protein coverage: | 93.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYT |
VEPSDTI.NVKAKI.DKEGIP.D.QRLIFAGKQLEDGR.LSDYNIQKESTLH.VLRL.GGAKKR.KKSYT | |
Retrocopy | VEPSDTIDNVKAKI*DKEGIPQDWQRLIFAGKQLEDGRILSDYNIQKESTLHVVLRLLGGAKKR-KKSYT |
Parental | TPKKNKHKRKKVKLAVLK--YYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT |
TPKKNK.KRKKVKLAVLK..YYKVDENGKIS.L..ECPSDECGAGVFMASHFDR.YC.KCCLT | |
Retrocopy | TPKKNKCKRKKVKLAVLKY*YYKVDENGKISHLHWECPSDECGAGVFMASHFDRPYCSKCCLT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 237 .06 RPM |
SRP012922_cerebellum | 0 .00 RPM | 193 .69 RPM |
SRP012922_heart | 0 .00 RPM | 170 .78 RPM |
SRP012922_kidney | 0 .00 RPM | 578 .26 RPM |
SRP012922_liver | 0 .00 RPM | 126 .32 RPM |
SRP012922_lung | 0 .00 RPM | 407 .77 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 192 .47 RPM |
SRP012922_spleen | 0 .00 RPM | 444 .11 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000004017 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000023471 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000010052 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000005819 | 7 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000004813 | 12 retrocopies | |
Erinaceus europaeus | ENSEEUG00000002329 | 9 retrocopies | |
Gorilla gorilla | ENSGGOG00000007678 | 9 retrocopies | |
Loxodonta africana | ENSLAFG00000023133 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000017064 | 10 retrocopies | |
Myotis lucifugus | ENSMLUG00000029449 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015563 | 8 retrocopies | |
Monodelphis domestica | ENSMODG00000001819 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000003613 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000025871 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000011928 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000004426 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000009566 | 5 retrocopies |