RetrogeneDB ID: | retro_dnov_2635 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_9275:33908..34327(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS27A | ||
| Ensembl ID: | ENSDNOG00000004813 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S27a [Source:HGNC Symbol;Acc:10417] |
| Percent Identity: | 88.73 % |
| Parental protein coverage: | 99.29 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | EPSDTIENVKAKIQDKEGI-PPDQQR-LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSY |
| EPS.TIENVKAKIQD.EGI.P..Q...LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKK.SY | |
| Retrocopy | EPSATIENVKAKIQD*EGILPDQQRL>LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKK-SY |
| Parental | TTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLT-YCFNKPE |
| TTPKKNK.KRKK.KLAVLKYYK.DENGKIS.LRRECPSDECGAGVFMASHFDRHYCGK.CLT..CFNKPE | |
| Retrocopy | TTPKKNKRKRKKAKLAVLKYYKMDENGKISCLRRECPSDECGAGVFMASHFDRHYCGKSCLT>NCFNKPE |
| Parental | DK |
| DK | |
| Retrocopy | DK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .19 RPM | 237 .06 RPM |
| SRP012922_cerebellum | 0 .69 RPM | 193 .69 RPM |
| SRP012922_heart | 0 .93 RPM | 170 .78 RPM |
| SRP012922_kidney | 1 .64 RPM | 578 .26 RPM |
| SRP012922_liver | 0 .46 RPM | 126 .32 RPM |
| SRP012922_lung | 2 .90 RPM | 407 .77 RPM |
| SRP012922_quadricep_muscle | 0 .87 RPM | 192 .47 RPM |
| SRP012922_spleen | 0 .92 RPM | 444 .11 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000004017 | 5 retrocopies | |
| Canis familiaris | ENSCAFG00000023471 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000010052 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000005819 | 7 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000004813 | 12 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000002329 | 9 retrocopies | |
| Gorilla gorilla | ENSGGOG00000007678 | 9 retrocopies | |
| Loxodonta africana | ENSLAFG00000023133 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017064 | 10 retrocopies | |
| Myotis lucifugus | ENSMLUG00000029449 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015563 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000001819 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000003613 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000025871 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000011928 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000004426 | 2 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000009566 | 5 retrocopies |