RetrogeneDB ID: | retro_dnov_1581 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_239230:7..388(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TSN | ||
Ensembl ID: | ENSDNOG00000025740 | ||
Aliases: | None | ||
Description: | translin [Source:HGNC Symbol;Acc:12379] |
Percent Identity: | 72.18 % |
Parental protein coverage: | 63.11 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | SLEQTAREILTLLQGVHQGAGFQDIP-KRCLKAR-EHFGTVKTHLTSLKTKFPAEQYYRFHEHWRFVLQR |
SLEQTA.EI..LLQG..QGAG..DI..KRCLKA..EHFGTVKTHLTSLK.KFP..QY.RFH.H.RFVLQ. | |
Retrocopy | SLEQTAPEIPALLQGNYQGAGMLDIQ<KRCLKAE<EHFGTVKTHLTSLKIKFPDDQYFRFHDHCRFVLQC |
Parental | LVFLAAFVVYLESETLVTREAVTEILGIEPDREKGFHLDVE-DYLSGVLILASELSRLSVNSV |
LV..AAF.V.LESETLVT.E.VTEI.G.E.D.EK.FHLDVE.DYL....IL.SELS.LSVNS. | |
Retrocopy | LV-SAAFAVFLESETLVTPELVTEIFGLELDGEKRFHLDVE<DYLY-EFILPSELSMLSVNSM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 11 .08 RPM |
SRP012922_cerebellum | 0 .00 RPM | 12 .37 RPM |
SRP012922_heart | 0 .00 RPM | 3 .25 RPM |
SRP012922_kidney | 0 .00 RPM | 6 .30 RPM |
SRP012922_liver | 0 .00 RPM | 5 .73 RPM |
SRP012922_lung | 0 .00 RPM | 8 .71 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 3 .81 RPM |
SRP012922_spleen | 0 .00 RPM | 11 .10 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000006059 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000025740 | 2 retrocopies |
retro_dnov_1581 , retro_dnov_907,
|
Felis catus | ENSFCAG00000027149 | 1 retrocopy | |
Homo sapiens | ENSG00000211460 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000002216 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000012656 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000021119 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000147 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001202 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000003457 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000023529 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000030436 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000012420 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000004395 | 1 retrocopy |