RetrogeneDB ID: | retro_dnov_1807 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_31340:11465..11699(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSDNOG00000005790 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | EIF1 | ||
| Ensembl ID: | ENSDNOG00000007856 | ||
| Aliases: | None | ||
| Description: | eukaryotic translation initiation factor 1 [Source:HGNC Symbol;Acc:3249] |
| Percent Identity: | 75.64 % |
| Parental protein coverage: | 69.03 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | QQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKD |
| QQR.GRK.LTT.Q.I..DY.KKKL.KAFKKKFA.NGT.IEH.E..EVIQLQ.DQRKNICQF.VE.GLA.D | |
| Retrocopy | QQRKGRKILTTIQEIPNDYNKKKLMKAFKKKFAGNGTLIEHLEHREVIQLQSDQRKNICQFRVETGLAND |
| Parental | DQLKVHGF |
| DQL..HGF | |
| Retrocopy | DQLNGHGF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 129 .71 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 132 .66 RPM |
| SRP012922_heart | 0 .00 RPM | 152 .68 RPM |
| SRP012922_kidney | 0 .00 RPM | 162 .36 RPM |
| SRP012922_liver | 0 .00 RPM | 167 .66 RPM |
| SRP012922_lung | 0 .00 RPM | 212 .90 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 339 .42 RPM |
| SRP012922_spleen | 0 .00 RPM | 177 .87 RPM |