RetrogeneDB ID: | retro_dnov_1985 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | scaffold_40391:12869..13195(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPS24 | ||
Ensembl ID: | ENSDNOG00000010243 | ||
Aliases: | None | ||
Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
Percent Identity: | 67.86 % |
Parental protein coverage: | 84.09 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | VTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGM |
VT...RKFMTNR..Q...MVI.VLHPGKAT........K...MYKTTPD.I.VFGFRTH.GGGKTTG..M | |
Retrocopy | VTLWMRKFMTNRPRQQERMVISVLHPGKATEDRNP--GKTSPMYKTTPDIISVFGFRTHLGGGKTTGIAM |
Parental | IYDSLDYAKK-NEPKHRLARHGLYEKKKTSRKQRKERKNRMK |
..DSLDYAKK.NEPKHRLAR.GLYE...TSRKQ..ERK.R.K | |
Retrocopy | M*DSLDYAKK<NEPKHRLARLGLYENTRTSRKQQMERKSRTK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 508 .73 RPM |
SRP012922_cerebellum | 0 .00 RPM | 443 .89 RPM |
SRP012922_heart | 0 .00 RPM | 344 .57 RPM |
SRP012922_kidney | 0 .00 RPM | 493 .11 RPM |
SRP012922_liver | 0 .00 RPM | 210 .38 RPM |
SRP012922_lung | 0 .00 RPM | 749 .27 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 541 .93 RPM |
SRP012922_spleen | 0 .00 RPM | 970 .06 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dasypus novemcinctus | ENSDNOG00000010243 | 18 retrocopies | |
Echinops telfairi | ENSETEG00000007481 | 32 retrocopies |
retro_etel_1119, retro_etel_1242, retro_etel_1274, retro_etel_1339, retro_etel_1395, retro_etel_1663, retro_etel_1688, retro_etel_1783, retro_etel_1800, retro_etel_1806, retro_etel_183, retro_etel_1901, retro_etel_1934, retro_etel_1978, retro_etel_1991, retro_etel_2040, retro_etel_2104, retro_etel_223, retro_etel_287, retro_etel_289, retro_etel_369, retro_etel_422, retro_etel_476, retro_etel_503, retro_etel_523, retro_etel_67, retro_etel_744, retro_etel_752, retro_etel_815, retro_etel_904, retro_etel_91, retro_etel_94,
|
Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000025091 | 3 retrocopies | |
Ornithorhynchus anatinus | ENSOANG00000006329 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000008090 | 3 retrocopies | |
Sus scrofa | ENSSSCG00000010328 | 8 retrocopies |