RetrogeneDB ID: | retro_dnov_1394 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_194464:665..1034(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPS24 | ||
| Ensembl ID: | ENSDNOG00000010243 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S24 [Source:HGNC Symbol;Acc:10411] |
| Percent Identity: | 77.17 % |
| Parental protein coverage: | 96.21 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TVTIRTRKFMTNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFG |
| TVTI.TRKFMTNRLLQRKQMVI.VLHPGKATVPKTEI.E...KMYKTTPDV.FVFGFRTHFGG.K.TGFG | |
| Retrocopy | TVTIWTRKFMTNRLLQRKQMVIGVLHPGKATVPKTEIQE---KMYKTTPDVVFVFGFRTHFGG-KITGFG |
| Parental | MIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMKKVRGTAKANVGAGKK |
| MIYDSLDYAKKNEPKHRLAR.GL.EK................KVR.T.KANVGAGKK | |
| Retrocopy | MIYDSLDYAKKNEPKHRLARYGLNEKXXXXXXXXXXXXXXXXKVRATVKANVGAGKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 508 .73 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 443 .89 RPM |
| SRP012922_heart | 0 .00 RPM | 344 .57 RPM |
| SRP012922_kidney | 0 .00 RPM | 493 .11 RPM |
| SRP012922_liver | 0 .00 RPM | 210 .38 RPM |
| SRP012922_lung | 0 .00 RPM | 749 .27 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 541 .93 RPM |
| SRP012922_spleen | 0 .23 RPM | 970 .06 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000010243 | 18 retrocopies | |
| Echinops telfairi | ENSETEG00000007481 | 32 retrocopies |
retro_etel_1119, retro_etel_1242, retro_etel_1274, retro_etel_1339, retro_etel_1395, retro_etel_1663, retro_etel_1688, retro_etel_1783, retro_etel_1800, retro_etel_1806, retro_etel_183, retro_etel_1901, retro_etel_1934, retro_etel_1978, retro_etel_1991, retro_etel_2040, retro_etel_2104, retro_etel_223, retro_etel_287, retro_etel_289, retro_etel_369, retro_etel_422, retro_etel_476, retro_etel_503, retro_etel_523, retro_etel_67, retro_etel_744, retro_etel_752, retro_etel_815, retro_etel_904, retro_etel_91, retro_etel_94,
|
| Gadus morhua | ENSGMOG00000012595 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000025091 | 3 retrocopies | |
| Ornithorhynchus anatinus | ENSOANG00000006329 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000008090 | 3 retrocopies | |
| Sus scrofa | ENSSSCG00000010328 | 8 retrocopies |