RetrogeneDB ID: | retro_dnov_289 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_3330:87936..88176(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSDNOG00000007732 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 76.25 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SVPSLAAGLFFGGLAGLGAYQLSQDPRNVWVFLVTSGTLAGIMGMRFYHSGKFMPAGLIAGVSLLMVAKL |
SVP.LAAGLFF.GLAGL.AYQLSQD..N.W.FL.TSGTLA.IMGMRF.HSGKFMPA...AG.SLL.VAKL | |
Retrocopy | SVPPLAAGLFFEGLAGLDAYQLSQDSMNIWDFLATSGTLADIMGMRFNHSGKFMPASITAGASLLRVAKL |
Parental | GISMFNGPHQ |
GIS..N..HQ | |
Retrocopy | GISILNRLHQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 45 .89 RPM |
SRP012922_cerebellum | 0 .00 RPM | 20 .76 RPM |
SRP012922_heart | 0 .00 RPM | 30 .86 RPM |
SRP012922_kidney | 0 .00 RPM | 84 .33 RPM |
SRP012922_liver | 0 .00 RPM | 86 .23 RPM |
SRP012922_lung | 0 .00 RPM | 41 .54 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 22 .67 RPM |
SRP012922_spleen | 0 .00 RPM | 188 .63 RPM |