RetrogeneDB ID: | retro_eeur_40 | ||
Retrocopy location | Organism: | Hedgehog (Erinaceus europaeus) | |
| Coordinates: | GeneScaffold_2407:42104..42326(-) | ||
| Located in intron of: | ENSEEUG00000013145 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSEEUG00000013161 | ||
| Aliases: | None | ||
| Description: | small ubiquitin-like modifier 1 [Source:HGNC Symbol;Acc:12502] |
| Percent Identity: | 86.84 % |
| Parental protein coverage: | 75.25 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQR |
| MS.QEAKPST.DLGDKKEGEYIKLKVIG.DSSEI..KV.MT..LKKLKESYCQRQGVPMNSLRFLFEGQR | |
| Retrocopy | MSVQEAKPSTDDLGDKKEGEYIKLKVIG*DSSEI--KVRMTMQLKKLKESYCQRQGVPMNSLRFLFEGQR |
| Parental | IADNHT |
| IADN.. | |
| Retrocopy | IADNQS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .00 RPM | 28 .36 RPM |
| SRP017611_kidney | 0 .00 RPM | 32 .07 RPM |
| SRP017611_liver | 0 .00 RPM | 14 .31 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009859 | 6 retrocopies | |
| Canis familiaris | ENSCAFG00000012431 | 8 retrocopies | |
| Equus caballus | ENSECAG00000024693 | 4 retrocopies | |
| Erinaceus europaeus | ENSEEUG00000013161 | 6 retrocopies | |
| Felis catus | ENSFCAG00000031005 | 6 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007504 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000000335 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030345 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000013083 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000012817 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000008205 | 8 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000011968 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000000642 | 4 retrocopies |