RetrogeneDB ID: | retro_cfam_386 | ||
Retrocopy location | Organism: | Dog (Canis familiaris) | |
| Coordinates: | 10:40837821..40837986(-) | ||
| Located in intron of: | ENSCAFG00000002147 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SUMO1 | ||
| Ensembl ID: | ENSCAFG00000012431 | ||
| Aliases: | None | ||
| Description: | Canis lupus familiaris SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) (SUMO1), mRNA. [Source:RefSeq mRNA;Acc:NM_001252263] |
| Percent Identity: | 73.21 % |
| Parental protein coverage: | 55.45 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | TTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTG |
| TTHL.KLKE..CQR..VP.NSLRFLFEGQRIA.NH.P.E.G..EEDV.EV.QEQ.G | |
| Retrocopy | TTHLQKLKEPSCQRLDVPVNSLRFLFEGQRIAENHSPREFG-AEEDVMEVCQEQMG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012049_cerebellum | 0 .00 RPM | 41 .79 RPM |
| SRP017611_brain | 0 .08 RPM | 29 .45 RPM |
| SRP017611_kidney | 0 .26 RPM | 72 .97 RPM |
| SRP017611_liver | 2 .61 RPM | 11 .75 RPM |