RetrogeneDB ID: | retro_ggal_19 | ||
Retrocopylocation | Organism: | Chicken (Gallus gallus) | |
Coordinates: | 8:8780988..8781218(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSGALG00000004039 | ||
Aliases: | MINOS1, C1orf151 | ||
Description: | None |
Percent Identity: | 83.33 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MASEGELGRKWDRCLADSAVKLGAGFGLGIVFSVIFFKRKTWPIAFGSGMGLGMAYSNCQHDFQSPYLLH |
MA.EGELGR.WD.CLADSAVKLGA..GL.IVFSVI.FKRKT.PIAFGSGMGLGMAY.NCQHDF.SPYLLH | |
Retrocopy | MALEGELGRNWDHCLADSAVKLGARIGLEIVFSVISFKRKT*PIAFGSGMGLGMAYFNCQHDFLSPYLLH |
Parental | GK-FVKEQ |
G..FVKE. | |
Retrocopy | GN<FVKEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 27 .72 RPM |
SRP007412_cerebellum | 0 .00 RPM | 23 .83 RPM |
SRP007412_heart | 0 .00 RPM | 76 .35 RPM |
SRP007412_kidney | 0 .00 RPM | 50 .31 RPM |
SRP007412_liver | 0 .00 RPM | 23 .23 RPM |
SRP007412_testis | 0 .00 RPM | 36 .62 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000003110 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
Felis catus | ENSFCAG00000003066 | 2 retrocopies | |
Homo sapiens | ENSG00000173436 | 3 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy |
retro_ggal_19 ,
|
Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000016199 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000028414 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000004024 | 1 retrocopy | |
Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000011525 | 1 retrocopy |