RetrogeneDB ID: | retro_mmul_1949 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 5:51229739..51229970(-) | ||
Located in intron of: | ENSMMUG00000002564 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSMMUG00000005855 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 64.56 % |
Parental protein coverage: | 98.72 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | SESELGRKWDRCLADAVVKIGTGFGLGIVFS-LTFFKRRMWPLAFG-SGMGLGMAYSNCQHDFQAPYLLH |
SE.EL.RK...CL.DAVVKIGTG..LG.V.S.L.FFKRR..PL.F...GM.LGMA.S...H.FQAP.LL. | |
Retrocopy | SEPELSRK*EQCLTDAVVKIGTGLELGLVSS>LNFFKRRK*PLTFS<FGMELGMAFSSRRHSFQAPCLLY |
Parental | GKYVKEQEQ |
G..VKEQEQ | |
Retrocopy | GTCVKEQEQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 37 .54 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 42 .92 RPM |
SRP007412_cerebellum | 0 .00 RPM | 33 .19 RPM |
SRP007412_heart | 0 .00 RPM | 82 .91 RPM |
SRP007412_kidney | 0 .12 RPM | 48 .71 RPM |
SRP007412_liver | 0 .00 RPM | 17 .26 RPM |
SRP007412_testis | 0 .00 RPM | 28 .50 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2948 |
Pan troglodytes | retro_ptro_2050 |
Gorilla gorilla | retro_ggor_2042 |
Pongo abelii | retro_pabe_2445 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
Homo sapiens | ENSG00000173436 | 3 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies |
retro_mmul_1268, retro_mmul_1949 ,
|
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |