RetrogeneDB ID: | retro_nleu_1297 | ||
Retrocopylocation | Organism: | Gibbon (Nomascus leucogenys) | |
Coordinates: | GL397288.1:6373337..6373568(+) | ||
Located in intron of: | ENSNLEG00000014881 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MINOS1 | ||
Ensembl ID: | ENSNLEG00000007867 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 89.61 % |
Parental protein coverage: | 98.72 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGK |
SESEL.RKWD.CLADA.VKIGTG.GLGIVFSL.FFKRRMWPLAF.SG.GLGMAYSNCQHDFQAPYLLHGK | |
Retrocopy | SESELCRKWDQCLADAAVKIGTGCGLGIVFSLIFFKRRMWPLAFSSGTGLGMAYSNCQHDFQAPYLLHGK |
Parental | YVKEQEQ |
YVKEQ.Q | |
Retrocopy | YVKEQQQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000006709 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000010942 | 5 retrocopies | |
Homo sapiens | ENSG00000173436 | 3 retrocopies | |
Gallus gallus | ENSGALG00000004039 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007347 | 4 retrocopies | |
Macaca mulatta | ENSMMUG00000005855 | 2 retrocopies | |
Mus musculus | ENSMUSG00000050608 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000007867 | 2 retrocopies |
retro_nleu_1297 , retro_nleu_665,
|
Pongo abelii | ENSPPYG00000001788 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000000269 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000042696 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000002903 | 1 retrocopy |