RetrogeneDB ID: | retro_ggor_1783 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 2b:65196842..65197054(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | DNAJC19 | ||
Ensembl ID: | ENSGGOG00000009120 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 71.23 % |
Parental protein coverage: | 62.07 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 1 |
Parental | VLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRI-MLLNH |
VLQA.KH..P.VKQ.FQSLPKSAFSGGY.RGG.EPK.TK.EAA.IL.VS.TA.KGK.RDA...I.M.LN. | |
Retrocopy | VLQARKHI*PEVKQDFQSLPKSAFSGGY*RGGLEPKRTKWEAA-ILPVSLTAIKGKVRDAQ*QI<MILNR |
Parental | PDK |
P.K | |
Retrocopy | PKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 9 .97 RPM |
SRP007412_cerebellum | 0 .20 RPM | 7 .05 RPM |
SRP007412_heart | 0 .06 RPM | 12 .98 RPM |
SRP007412_kidney | 0 .20 RPM | 16 .48 RPM |
SRP007412_liver | 0 .08 RPM | 12 .34 RPM |
SRP007412_testis | 0 .52 RPM | 6 .22 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2349 |
Pan troglodytes | retro_ptro_1719 |
Pongo abelii | retro_pabe_2126 |
Macaca mulatta | retro_mmul_946 |