RetrogeneDB ID: | retro_ggor_698 | ||
Retrocopy location | Organism: | Gorilla (Gorilla gorilla) | |
| Coordinates: | 11:18686327..18686744(-) | ||
| Located in intron of: | ENSGGOG00000010350 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | WBP2 | ||
| Ensembl ID: | ENSGGOG00000009241 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.78 % |
| Parental protein coverage: | 54.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 5 |
| Parental | TFTAGGAIEFGQRMLQVASQASRGE-VPSGAYGYSYMPSGAYV-YPPPVANGMYPCPPGYPYPPPPPEFY |
| TFTAG...EFGQ..L.VA..ASRG...PSGAY..SYMP.GA....P.P.A....P....Y.YPPPPPEFY | |
| Retrocopy | TFTAGSITEFGQWVLRVAV*ASRGK<APSGAYRCSYMPGGACA<LPSPAAMECTPALL-YSYPPPPPEFY |
| Parental | PGPPMMDGAMGYVQPPPP-PYPGP-MEPPVSGPDVPSTPAAEA-KAAEAAASAYYNPGNPHNVYMPTSQP |
| .GPP.MD.AM..VQP....PYPGP..EP....P..PS.PAA.A...A.A.A..YYN.GN.HN.YM...QP | |
| Retrocopy | LGPPIMDRAMKQVQPHGT>PYPGP<LEPSIRSPKIPSIPAAKA<REAAARA--YYNLGNSHNIYMHRYQP |
| Parental | PPPPYYPP |
| PPPPYYPP | |
| Retrocopy | PPPPYYPP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 352 .56 RPM |
| SRP007412_cerebellum | 0 .04 RPM | 259 .36 RPM |
| SRP007412_heart | 0 .06 RPM | 77 .96 RPM |
| SRP007412_kidney | 0 .08 RPM | 85 .38 RPM |
| SRP007412_liver | 0 .03 RPM | 60 .85 RPM |
| SRP007412_testis | 0 .73 RPM | 141 .52 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000004946 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000037619 | 1 retrocopy | |
| Felis catus | ENSFCAG00000005760 | 1 retrocopy | |
| Homo sapiens | ENSG00000132471 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000009241 | 2 retrocopies |
retro_ggor_1404, retro_ggor_698 ,
|
| Macropus eugenii | ENSMEUG00000000070 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009381 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000007725 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000013775 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000001625 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000006045 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000008640 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000009660 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000021421 | 2 retrocopies |