RetrogeneDB ID: | retro_mmul_854 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 11:32304232..32304625(-) | ||
Located in intron of: | ENSMMUG00000007395 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.1627 | ||
Ensembl ID: | ENSMMUG00000009381 | ||
Aliases: | None | ||
Description: | WW domain-binding protein 2 [Source:RefSeq peptide;Acc:NP_001245028] |
Percent Identity: | 58.52 % |
Parental protein coverage: | 50.96 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | EFGQRMLQVASQASRGEAPNGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFYPGPPMMDGAM |
.FGQ.MLQVA.QASRGEAPN..YGYSY.P..AYV.P.P..NG.Y.CP.G.P.P..P.EFYPGPPM.DGAM | |
Retrocopy | QFGQ*MLQVAFQASRGEAPNRPYGYSYIPNRAYVFPLPITNGTYLCPSGCPNPQSPSEFYPGPPMVDGAM |
Parental | GYVQPPPPPYPGP-MEPPVSGPDVPSTPAAEAKAAEAAASAYYNP-GNPHNVYMPTSQPPPPPYY |
G.......PY.G..MEP.VSGP..P..P.A.A.A...AA.A.....GNPHN.Y....QP.P..YY | |
Retrocopy | GCLHSLSLPYLGS<MEPLVSGPIGPG-PSALA-AKVRAAEAAVSA>GNPHNTYILRNQPLPLHYY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 152 .84 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 354 .68 RPM |
SRP007412_cerebellum | 0 .13 RPM | 152 .98 RPM |
SRP007412_heart | 0 .06 RPM | 69 .37 RPM |
SRP007412_kidney | 0 .12 RPM | 119 .95 RPM |
SRP007412_liver | 0 .00 RPM | 122 .79 RPM |
SRP007412_testis | 0 .00 RPM | 209 .01 RPM |
Species | RetrogeneDB ID |
---|---|
Pongo abelii | retro_pabe_913 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000004946 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000037619 | 1 retrocopy | |
Felis catus | ENSFCAG00000005760 | 1 retrocopy | |
Homo sapiens | ENSG00000132471 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000009241 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000000070 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000009381 | 2 retrocopies |
retro_mmul_1062, retro_mmul_854 ,
|
Monodelphis domestica | ENSMODG00000007725 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000013775 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000001625 | 1 retrocopy | |
Ochotona princeps | ENSOPRG00000006045 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000008640 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000009660 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000021421 | 2 retrocopies |