RetrogeneDB ID: | retro_ggor_903 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:111563903..111564149(-) | ||
Located in intron of: | ENSGGOG00000003794 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | IER3IP1 | ||
Ensembl ID: | ENSGGOG00000027939 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.8 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
MAFTLYSLLQAALLCV.AIA.LH.ERFLKNIGW..DQ.IGGFGEEPGIKSQLMN.I.SV.TVMR.PLIIV | |
Retrocopy | MAFTLYSLLQAALLCVSAIAMLHKERFLKNIGWRIDQRIGGFGEEPGIKSQLMNRIQSVTTVMRMPLIIV |
Parental | NSIAIVLLLLFG |
NSIAIVLLLLFG | |
Retrocopy | NSIAIVLLLLFG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .10 RPM | 5 .32 RPM |
SRP007412_cerebellum | 0 .08 RPM | 8 .79 RPM |
SRP007412_heart | 0 .09 RPM | 2 .63 RPM |
SRP007412_kidney | 0 .04 RPM | 10 .26 RPM |
SRP007412_liver | 0 .00 RPM | 9 .63 RPM |
SRP007412_testis | 0 .10 RPM | 7 .36 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1156 |
Pan troglodytes | retro_ptro_791 |
Pongo abelii | retro_pabe_962 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy |
retro_ggor_903 ,
|
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |