RetrogeneDB ID: | retro_ogar_2152 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873596.1:8325482..8325698(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOGAG00000016626 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 53.25 % |
Parental protein coverage: | 93.9 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | YSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLVNLIRSVRTVMRVPLIIVNSVAI |
.S..QAALLCV.A......E...K..G..T....G...E.P.IKSQ.VNLI.SVR...RVPL...NS.AI | |
Retrocopy | HSCRQAALLCVKATEAIPQE---KSAGKQTVELVGS--EKPAIKSQPVNLIQSVRITTRVPLMTMNSIAI |
Parental | VLLLLFG |
.LLLLFG | |
Retrocopy | ALLLLFG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy |
retro_ogar_2152 ,
|
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |