RetrogeneDB ID: | retro_mmus_150 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 13:49945095..49945335(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000094886 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Ier3ip1 | ||
| Ensembl ID: | ENSMUSG00000090000 | ||
| Aliases: | Ier3ip1, 1110057H19Rik, AI644142, AL022842, AL022863, AV026606 | ||
| Description: | immediate early response 3 interacting protein 1 [Source:MGI Symbol;Acc:MGI:1913441] |
| Percent Identity: | 87.8 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
| MAFTLYSLMQAALLC...I.VL.EE.FLKNIGWGTDQGI.GFGEE.GIKSQLMNLIRSVRTVMRVPL.IV | |
| Retrocopy | MAFTLYSLMQAALLC---ISVLQEEHFLKNIGWGTDQGISGFGEESGIKSQLMNLIRSVRTVMRVPLTIV |
| Parental | NSITIVLLLLFG |
| .SITIVLLLLFG | |
| Retrocopy | SSITIVLLLLFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 17 .92 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 11 .94 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .49 RPM |
| SRP007412_kidney | 0 .02 RPM | 11 .26 RPM |
| SRP007412_liver | 0 .00 RPM | 4 .72 RPM |
| SRP007412_testis | 0 .00 RPM | 10 .66 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy |
retro_mmus_150 ,
|
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |