RetrogeneDB ID: | retro_ttru_1930 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_99177:3825..4044(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSTTRG00000001019 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 56.16 % |
Parental protein coverage: | 89.02 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | FTLYSLLQAALLCVNAIAVLHEERFLKNIGWATDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIVNS |
..LY...Q.ALL...A.AVLH.E...KN..W..DQGIG.F.EE...KSQL.NLIRS.....RV.LIIVNS | |
Retrocopy | YCLYQPPQVALLLIDATAVLHGECSFKNMSWGVDQGIGRFEEELELKSQLRNLIRSI*IIIRVLLIIVNS |
Parental | IAI |
..I | |
Retrocopy | TEI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
Homo sapiens | ENSG00000134049 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |
retro_ttru_1930 ,
|