RetrogeneDB ID: | retro_btau_13 | ||
Retrocopy location | Organism: | Cow (Bos taurus) | |
| Coordinates: | 11:73186222..73186471(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSBTAG00000017330 | |
| Aliases: | None | ||
| Status: | KNOWN_PROTEIN_CODING | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | IER3IP1 | ||
| Ensembl ID: | ENSBTAG00000032961 | ||
| Aliases: | None | ||
| Description: | Immediate early response 3-interacting protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q1JQC2] |
| Percent Identity: | 100.0 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
| MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV | |
| Retrocopy | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
| Parental | NSIAIVLLLLFG |
| NSIAIVLLLLFG | |
| Retrocopy | NSIAIVLLLLFG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| ERP005899_liver | 0 .22 RPM | 26 .17 RPM |
| ERP005899_muscle | 0 .16 RPM | 32 .25 RPM |
| SRP017611_brain | 0 .05 RPM | 8 .04 RPM |
| SRP017611_kidney | 0 .06 RPM | 13 .75 RPM |
| SRP017611_liver | 0 .00 RPM | 10 .80 RPM |
| SRP030211_testis | 0 .74 RPM | 20 .39 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy |
retro_btau_13 ,
|
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |