RetrogeneDB ID: | retro_tbel_2783 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | scaffold_119048:46631..46856(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTBEG00000001443 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 78.67 % |
| Parental protein coverage: | 91.46 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWATDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV |
| MAFTLYSLLQAALLCV.A..VL.EE..LK..G..T.QGIG.FGEEPGIKSQLM.LIRSVRTVMRV.LIIV | |
| Retrocopy | MAFTLYSLLQAALLCVEAVTVLREECLLKSFG*GTEQGIGRFGEEPGIKSQLMKLIRSVRTVMRVLLIIV |
| Parental | NSVAI |
| NSV.. | |
| Retrocopy | NSVQL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000032961 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000004610 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000000303 | 1 retrocopy | |
| Homo sapiens | ENSG00000134049 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027939 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000090000 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011450 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000016626 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009141 | 3 retrocopies | |
| Pan troglodytes | ENSPTRG00000010002 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000001443 | 4 retrocopies | |
| Tursiops truncatus | ENSTTRG00000001019 | 1 retrocopy |