RetrogeneDB ID: | retro_mdom_811 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:61197427..61197670(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPF | ||
Ensembl ID: | ENSMODG00000008091 | ||
Aliases: | None | ||
Description: | small nuclear ribonucleoprotein polypeptide F [Source:HGNC Symbol;Acc:11162] |
Percent Identity: | 60.24 % |
Parental protein coverage: | 71.05 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | NPKPFLNGLTGKPVMVKLKW-GMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRG |
NPK.FLN.L.GKPVM.K.....M.YK..LV.VDGYMN.....T.EY....LS..LGE..IRCNN.L.IR. | |
Retrocopy | NPKLFLNRLAGKPVMLKVSR<AMWYKDQLVLVDGYMNI*FESTGEYVGRVLSAYLGEI*IRCNNILHIRS |
Parental | VEEEEED-GEMRE |
VE.EEED.GEM.E | |
Retrocopy | VEKEEED>GEMQE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000002166 | 3 retrocopies | |
Canis familiaris | ENSCAFG00000006395 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002705 | 2 retrocopies | |
Felis catus | ENSFCAG00000029966 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies |
retro_mdom_550, retro_mdom_780, retro_mdom_811 ,
|
Tarsius syrichta | ENSTSYG00000006837 | 4 retrocopies |