RetrogeneDB ID: | retro_mdom_621 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 1:557552662..557552903(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | LSM6 | ||
Ensembl ID: | ENSMODG00000000526 | ||
Aliases: | None | ||
Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
Percent Identity: | 87.65 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDG-YMNIALEQTEEYVNGQLKNKYGDAFIRGNN |
MSLRKQTP.DFLKQIIGRPVVVKLNSGVDY.GVL.CLDG..MNIA.EQTE.YVNGQLKN.YGDAFIRGNN | |
Retrocopy | MSLRKQTPTDFLKQIIGRPVVVKLNSGVDYQGVLTCLDG>NMNIAQEQTEDYVNGQLKNQYGDAFIRGNN |
Parental | VLYISTQKRRM |
VL..STQKRRM | |
Retrocopy | VLCRSTQKRRM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
Homo sapiens | ENSG00000164167 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |