RetrogeneDB ID: | retro_mdom_1983 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | Un:52098635..52098876(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | LSM6 | ||
| Ensembl ID: | ENSMODG00000000526 | ||
| Aliases: | None | ||
| Description: | LSM6 homolog, U6 small nuclear RNA associated (S. cerevisiae) [Source:HGNC Symbol;Acc:17017] |
| Percent Identity: | 87.65 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDG-YMNIALEQTEEYVNGQLKNKYGDAFIRGNN |
| MSLRKQTP.DFLKQIIGRPVVVKLNSGVDY.GVL.CLDG..MNIA.EQTE.YVNGQLKN.YGDAFIRGNN | |
| Retrocopy | MSLRKQTPTDFLKQIIGRPVVVKLNSGVDYQGVLTCLDG>NMNIAQEQTEDYVNGQLKNQYGDAFIRGNN |
| Parental | VLYISTQKRRM |
| VL..STQKRRM | |
| Retrocopy | VLCRSTQKRRM |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014060 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000015389 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000009322 | 5 retrocopies | |
| Homo sapiens | ENSG00000164167 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001310 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000026355 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000000526 | 4 retrocopies | |
| Monodelphis domestica | ENSMODG00000008091 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000005584 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000026665 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000009036 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012759 | 4 retrocopies |