RetrogeneDB ID: | retro_meug_1503 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold427713:388..642(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D3 | ||
Ensembl ID: | ENSMEUG00000004256 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476] |
Percent Identity: | 83.72 % |
Parental protein coverage: | 61.15 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | ELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGSVFFLTIHFPTDYPFKPPKVAFTTRIYHPN |
.L.DLA.DPPAQCSAGPVGD...FHWQAT.M.PNDSPYQG.VFFLTIHFPTDYPFKPPKVAFTTR.YHP. | |
Retrocopy | KLRDLACDPPAQCSAGPVGDI<LFHWQATVMVPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRMYHPS |
Parental | INSNGSICLDILRSQW |
I.SNGSICLDILRS.. | |
Retrocopy | ISSNGSICLDILRSKF |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000004649 | 2 retrocopies | |
Ciona intestinalis | ENSCING00000018711 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015492 | 3 retrocopies | |
Ciona savignyi | ENSCSAVG00000006136 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000006762 | 2 retrocopies | |
Equus caballus | ENSECAG00000020678 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000014658 | 3 retrocopies | |
Echinops telfairi | ENSETEG00000001291 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000004256 | 6 retrocopies | |
Macropus eugenii | ENSMEUG00000007238 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000014517 | 1 retrocopy | |
Ornithorhynchus anatinus | ENSOANG00000005415 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000014967 | 1 retrocopy | |
Pteropus vampyrus | ENSPVAG00000015438 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000024306 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000029822 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000000270 | 5 retrocopies |