RetrogeneDB ID: | retro_ecab_859 | ||
Retrocopylocation | Organism: | Horse (Equus caballus) | |
Coordinates: | 5:49662928..49663160(-) | ||
Located in intron of: | ENSECAG00000015266 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2D3 | ||
Ensembl ID: | ENSECAG00000020678 | ||
Aliases: | None | ||
Description: | ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476] |
Percent Identity: | 80.25 % |
Parental protein coverage: | 56.83 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | SAGPVGDDMFHWQATIMGPNDSPYQGGVFF-LTIHFPTDYPFKPPKVAFTTRIYHP-NINSNGSICLDIL |
S.GP.GDD.FHW.ATIM.PNDS.YQG.VFF.LTIH.PTDYPFK.PKVAFT.RIY...NIN.NGSICLDIL | |
Retrocopy | STGPAGDDEFHWRATIMEPNDSTYQGNVFF<LTIHSPTDYPFKSPKVAFT-RIYYQ<NINNNGSICLDIL |
Parental | RSQWSPALTIS |
RSQWS.ALTIS | |
Retrocopy | RSQWSLALTIS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP021940_articular_cartilage | 0 .00 RPM | 36 .36 RPM |
SRP021940_cerebellum | 0 .00 RPM | 36 .77 RPM |
SRP021940_embryo | 0 .03 RPM | 43 .78 RPM |
SRP021940_placental_villous | 0 .00 RPM | 73 .90 RPM |
SRP021940_synovial_membrane | 0 .03 RPM | 34 .67 RPM |
SRP021940_testis | 0 .00 RPM | 88 .18 RPM |
Species | RetrogeneDB ID |
---|---|
Bos taurus | retro_btau_1261 |