RetrogeneDB ID: | retro_tbel_1336 | ||
Retrocopy location | Organism: | Treeshrew (Tupaia belangeri) | |
| Coordinates: | GeneScaffold_4421:593697..593924(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSTBEG00000000270 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 76.92 % |
| Parental protein coverage: | 65.81 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | IHFPTDYP-FKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPE |
| .HFPTDYP.FKPPKVA..TRIYHPNINSNGSICLDILR...S..LT.SKVLLSI.SLLCDP.PDD.LVP. | |
| Retrocopy | VHFPTDYP<FKPPKVAL-TRIYHPNINSNGSICLDILR***SLTLTLSKVLLSIFSLLCDPIPDDSLVPG |
| Parental | IARIYKTD |
| IA...KT. | |
| Retrocopy | IAQVCKTE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |