RetrogeneDB ID: | retro_mmul_1227 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 16:32938442..32938668(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX6B1 | ||
Ensembl ID: | ENSMMUG00000016765 | ||
Aliases: | COX6B1, COX6B | ||
Description: | Cytochrome c oxidase subunit 6B1 [Source:UniProtKB/Swiss-Prot;Acc:Q53CG4] |
Percent Identity: | 71.05 % |
Parental protein coverage: | 86.21 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | YKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTTKGGNVSVCEWYQRVYQSLCPTSWVTDWDEQRAEGT |
YKTAPFDS.FPNQNQ.RNC.Q.YLDFH.C.KAM..K..NV.VCE.YQ.VY.SL.P.S.V..WDE..AEGT | |
Retrocopy | YKTAPFDSSFPNQNQPRNCLQDYLDFHLCEKAMIAKRDNVCVCE*YQPVYKSLIPIS*VSAWDEHWAEGT |
Parental | -FPGKI |
.FPGKI | |
Retrocopy | >FPGKI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 57 .71 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 112 .09 RPM |
SRP007412_cerebellum | 0 .00 RPM | 53 .86 RPM |
SRP007412_heart | 0 .00 RPM | 136 .67 RPM |
SRP007412_kidney | 0 .00 RPM | 115 .14 RPM |
SRP007412_liver | 0 .00 RPM | 121 .25 RPM |
SRP007412_testis | 0 .00 RPM | 14 .44 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1762 |
Pan troglodytes | retro_ptro_1209 |