RetrogeneDB ID: | retro_mmul_1663 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 3:7135878..7136295(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MMU.2449 | ||
Ensembl ID: | ENSMMUG00000031838 | ||
Aliases: | None | ||
Description: | myosin, light polypeptide 6, alkali, smooth muscle and non-muscle [Source:RefSeq peptide;Acc:NP_001180478] |
Percent Identity: | 75.89 % |
Parental protein coverage: | 91.39 % |
Number of stop codons detected: | 4 |
Number of frameshifts detected | 2 |
Parental | MCDFTEDQTAEFKEAFQLFDRTGDGKIL-YSQCGDVMRALGQNPTNAEVLKVLGNP-KSDEMNVKVLDFE |
.C.F.E.QTAEFK.AFQLFD.TGDGK.L.YSQCGD..R.LGQ.PT.AEV...LG.P..SDEMNVKVLDF. | |
Retrocopy | ICNFIENQTAEFKNAFQLFD*TGDGKVL<YSQCGDMTRVLGQSPTHAEVFQFLGEP>RSDEMNVKVLDFG |
Parental | HFLPMLQTVAKNKDQGTYE-DYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNG |
HFL.MLQTVA.NKD.G....DYVEGL.VFDKE.NGT.MGAEI..VLVTLG.KMTEEEVEML.AGHEDSNG | |
Retrocopy | HFLLMLQTVARNKD*GV*S*DYVEGLWVFDKERNGTIMGAEIWQVLVTLGGKMTEEEVEMLAAGHEDSNG |
Parental | C |
C | |
Retrocopy | C |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .11 RPM | 57 .37 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 100 .91 RPM |
SRP007412_cerebellum | 0 .06 RPM | 58 .05 RPM |
SRP007412_heart | 0 .24 RPM | 265 .63 RPM |
SRP007412_kidney | 0 .00 RPM | 173 .24 RPM |
SRP007412_liver | 0 .00 RPM | 100 .82 RPM |
SRP007412_testis | 0 .04 RPM | 37 .47 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Homo sapiens | ENSG00000092841 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000001272 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000005214 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000031838 | 6 retrocopies | |
Mus musculus | ENSMUSG00000090841 | 7 retrocopies | |
Nomascus leucogenys | ENSNLEG00000000205 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000017371 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000034596 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000004647 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000005080 | 2 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000004472 | 6 retrocopies | |
Sus scrofa | ENSSSCG00000025467 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000023318 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000000485 | 8 retrocopies |