RetrogeneDB ID: | retro_mmul_2359 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 8:98526203..98526499(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SRSF3 | ||
| Ensembl ID: | ENSMMUG00000014306 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 58.0 % |
| Parental protein coverage: | 60.37 % |
| Number of stop codons detected: | 4 |
| Number of frameshifts detected: | 1 |
| Parental | RDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRR-SPRRRSFSRSR |
| .DAADAV.ELDGR.L..C.VR.ELSNGEKRSRN.GPP.S....PRDD..R..PP..RR.S......S... | |
| Retrocopy | QDAADAV*ELDGRWLGDCPVRIELSNGEKRSRNDGPPIS*DCHPRDDHHRSPPPLHRR<SKKEKLLSQGE |
| Parental | SRSLSRDRRRERSLSRERNHKPSRSFSRSR |
| .....R.....RSLS.E.NHKPSRSFSRS. | |
| Retrocopy | CLPF*R*EKTRRSLSWEKNHKPSRSFSRSQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 75 .63 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 61 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 107 .84 RPM |
| SRP007412_heart | 0 .00 RPM | 91 .04 RPM |
| SRP007412_kidney | 0 .00 RPM | 86 .50 RPM |
| SRP007412_liver | 0 .00 RPM | 51 .10 RPM |
| SRP007412_testis | 0 .00 RPM | 140 .14 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_2776 |
| Gorilla gorilla | retro_ggor_2746 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000016062 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000010117 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000018193 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000010671 | 6 retrocopies | |
| Macaca mulatta | ENSMMUG00000014306 | 4 retrocopies | |
| Macaca mulatta | ENSMMUG00000016494 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000071172 | 9 retrocopies | |
| Otolemur garnettii | ENSOGAG00000000502 | 6 retrocopies | |
| Sus scrofa | ENSSSCG00000001564 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000014280 | 5 retrocopies |