RetrogeneDB ID: | retro_opri_489 | ||
Retrocopy location | Organism: | Southern American pika (Ochotona princeps) | |
| Coordinates: | scaffold_13737:10633..10804(-) | ||
| Located in intron of: | ENSOPRG00000010040 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UQCRH | ||
| Ensembl ID: | ENSOPRG00000016059 | ||
| Aliases: | None | ||
| Description: | ubiquinol-cytochrome c reductase hinge protein [Source:HGNC Symbol;Acc:12590] |
| Percent Identity: | 84.21 % |
| Parental protein coverage: | 62.64 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MGLEDERKMLTGAGDPKEEEEEEEELVDPLATVREQCEQLEKCVKARERLELCDERV |
| MGLEDE.K.LTGAGDPKEE.EEEEELV.PL.T.REQ.EQLEKCVKARER.ELC.ERV | |
| Retrocopy | MGLEDEQKVLTGAGDPKEEGEEEEELVGPLSTAREQREQLEKCVKARERGELCGERV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000009603 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000021126 | 5 retrocopies | |
| Homo sapiens | ENSG00000173660 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010631 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000006850 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000063882 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000016523 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000007600 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000001134 | 2 retrocopies | |
| Ochotona princeps | ENSOPRG00000016059 | 1 retrocopy |
retro_opri_489 ,
|
| Pongo abelii | ENSPPYG00000025831 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000000691 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000012550 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000006763 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000011608 | 2 retrocopies | |
| Tarsius syrichta | ENSTSYG00000006572 | 2 retrocopies | |
| Tursiops truncatus | ENSTTRG00000006326 | 1 retrocopy |