RetrogeneDB ID: | retro_pabe_717 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 11:78976937..78977174(+) | ||
| Located in intron of: | ENSPPYG00000003735 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSPPYG00000000768 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 94.94 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| MSHKQIYYSDKYDDEE.EYRHV.LPKDIAKLV.K.HLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR | |
| Retrocopy | MSHKQIYYSDKYDDEELEYRHVVLPKDIAKLVRKPHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| Parental | RPLPKKPKK |
| RPLPKKPKK | |
| Retrocopy | RPLPKKPKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .81 RPM |
| SRP007412_cerebellum | 0 .12 RPM | 1 .58 RPM |
| SRP007412_heart | 0 .03 RPM | 5 .54 RPM |
| SRP007412_kidney | 0 .00 RPM | 8 .49 RPM |
| SRP007412_liver | 0 .03 RPM | 8 .29 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Pan troglodytes | retro_ptro_558 |
| Gorilla gorilla | retro_ggor_659 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
| Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
| Pongo abelii | ENSPPYG00000000768 | 3 retrocopies |
retro_pabe_1143, retro_pabe_3625, retro_pabe_717 ,
|
| Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |