RetrogeneDB ID: | retro_btau_1573 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 7:41989228..41989601(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUTF2 | ||
Ensembl ID: | ENSBTAG00000006414 | ||
Aliases: | None | ||
Description: | Nuclear transport factor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q32KP9] |
Percent Identity: | 81.89 % |
Parental protein coverage: | 98.43 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 2 |
Parental | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSS-LPFQKIQHSIT |
MGDKP.WEQIGSSFIQHYYQLFDNDR.QLGA.Y.DAS..TWEGQQFQGKAAIV.KL.S.LPFQK.QHSI. | |
Retrocopy | MGDKPVWEQIGSSFIQHYYQLFDNDRIQLGAVYFDASGFTWEGQQFQGKAAIVKKLPS<LPFQKTQHSIM |
Parental | AQDHQPTPDSCIISMVV-GQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHN |
AQDHQP.PDSCIIS.V..GQL.A.EDPIM.FHQMF.LK.I..AW.CTNDMFRLALHN | |
Retrocopy | AQDHQPMPDSCIISTVL<GQLEANEDPIMWFHQMFQLKSIKVAWICTNDMFRLALHN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 19 .68 RPM |
ERP005899_muscle | 0 .00 RPM | 49 .99 RPM |
SRP017611_brain | 0 .00 RPM | 30 .19 RPM |
SRP017611_kidney | 0 .00 RPM | 36 .39 RPM |
SRP017611_liver | 0 .00 RPM | 15 .18 RPM |
SRP030211_testis | 0 .07 RPM | 24 .03 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017548 | 5 retrocopies | |
Bos taurus | ENSBTAG00000006414 | 2 retrocopies |
retro_btau_1573 , retro_btau_881,
|
Cavia porcellus | ENSCPOG00000003521 | 1 retrocopy | |
Erinaceus europaeus | ENSEEUG00000003470 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000023925 | 5 retrocopies | |
Macropus eugenii | ENSMEUG00000009874 | 11 retrocopies | |
Myotis lucifugus | ENSMLUG00000025175 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000012038 | 6 retrocopies | |
Monodelphis domestica | ENSMODG00000005517 | 6 retrocopies | |
Mus musculus | ENSMUSG00000008450 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000006322 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015568 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000018945 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006100 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030295 | 3 retrocopies | |
Tupaia belangeri | ENSTBEG00000011016 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009251 | 2 retrocopies | |
Drosophila melanogaster | FBgn0031145 | 1 retrocopy |