RetrogeneDB ID: | retro_meug_1023 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold262510:696..934(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUTF2 | ||
Ensembl ID: | ENSMEUG00000009874 | ||
Aliases: | None | ||
Description: | nuclear transport factor 2 [Source:HGNC Symbol;Acc:13722] |
Percent Identity: | 51.81 % |
Parental protein coverage: | 64.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | DKPIWEQIGSSFVQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQD |
.K.IW.....SFVQHY.Q.F.....QL..I.....C.TW.G.Q.QGK..I.EKL.SLPF.KIQHS.TA.. | |
Retrocopy | NKLIWKHTRFSFVQHYLQ*FKKYKIQLVTI---RTCYTW*GKQMQGKENIMEKLFSLPFHKIQHSDTAEG |
Parental | HQPTPD-SCILSM |
H..T....CIL.M | |
Retrocopy | HLLTLT>DCILNM |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |