RetrogeneDB ID: | retro_mmul_2127 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:13624055..13624283(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUTF2 | ||
| Ensembl ID: | ENSMMUG00000012038 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 84.42 % |
| Parental protein coverage: | 60.63 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA |
| MGD.PIWEQI.SSFIQHYYQLF.N..TQLGAIYID..CL.WEG.QFQGKAA.VE.LSS.PFQKIQHSITA | |
| Retrocopy | MGDEPIWEQI*SSFIQHYYQLFHNEKTQLGAIYIDVPCLMWEGWQFQGKAATVE-LSSHPFQKIQHSITA |
| Parental | QDHQPTP |
| QDHQPTP | |
| Retrocopy | QDHQPTP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 17 .82 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .22 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 14 .72 RPM |
| SRP007412_heart | 0 .12 RPM | 18 .25 RPM |
| SRP007412_kidney | 0 .00 RPM | 20 .54 RPM |
| SRP007412_liver | 0 .00 RPM | 23 .24 RPM |
| SRP007412_testis | 0 .04 RPM | 14 .63 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1480 |
| Pan troglodytes | retro_ptro_1001 |
| Pongo abelii | retro_pabe_1229 |