RetrogeneDB ID: | retro_mmul_2127 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 7:13624055..13624283(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NUTF2 | ||
Ensembl ID: | ENSMMUG00000012038 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.42 % |
Parental protein coverage: | 60.63 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITA |
MGD.PIWEQI.SSFIQHYYQLF.N..TQLGAIYID..CL.WEG.QFQGKAA.VE.LSS.PFQKIQHSITA | |
Retrocopy | MGDEPIWEQI*SSFIQHYYQLFHNEKTQLGAIYIDVPCLMWEGWQFQGKAATVE-LSSHPFQKIQHSITA |
Parental | QDHQPTP |
QDHQPTP | |
Retrocopy | QDHQPTP |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 17 .82 RPM |
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 35 .22 RPM |
SRP007412_cerebellum | 0 .00 RPM | 14 .72 RPM |
SRP007412_heart | 0 .12 RPM | 18 .25 RPM |
SRP007412_kidney | 0 .00 RPM | 20 .54 RPM |
SRP007412_liver | 0 .00 RPM | 23 .24 RPM |
SRP007412_testis | 0 .04 RPM | 14 .63 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1480 |
Pan troglodytes | retro_ptro_1001 |
Pongo abelii | retro_pabe_1229 |