RetrogeneDB ID: | retro_cpor_1368 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_73:7204416..7204622(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NUTF2 | ||
| Ensembl ID: | ENSCPOG00000003521 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 63.38 % |
| Parental protein coverage: | 55.12 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | IDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSIT-AQDHQPTPDSCIISMVVGQLKADEDPIMGFHQM |
| I..SCLT...Q..Q.....VEKL..LPF.KIQHSI..A..HQP.PDSCI.SM.VGQ..A.EDPI.GFHQM | |
| Retrocopy | IHPSCLT*G*QHLQDESVVVEKLLILPFLKIQHSIK<ALNHQPIPDSCI-SMAVGQFWANEDPIVGFHQM |
| Parental | F |
| F | |
| Retrocopy | F |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .12 RPM | 13 .98 RPM |
| SRP017611_kidney | 0 .10 RPM | 23 .14 RPM |
| SRP017611_liver | 0 .00 RPM | 9 .92 RPM |
| SRP040447_lung | 0 .13 RPM | 25 .67 RPM |
| SRP040447_skeletal_muscle | 0 .01 RPM | 36 .33 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000017548 | 5 retrocopies | |
| Bos taurus | ENSBTAG00000006414 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000003521 | 1 retrocopy |
retro_cpor_1368 ,
|
| Erinaceus europaeus | ENSEEUG00000003470 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023925 | 5 retrocopies | |
| Macropus eugenii | ENSMEUG00000009874 | 11 retrocopies | |
| Myotis lucifugus | ENSMLUG00000025175 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000012038 | 6 retrocopies | |
| Monodelphis domestica | ENSMODG00000005517 | 6 retrocopies | |
| Mus musculus | ENSMUSG00000008450 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000006322 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015568 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018945 | 4 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000006100 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030295 | 3 retrocopies | |
| Tupaia belangeri | ENSTBEG00000011016 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009251 | 2 retrocopies | |
| Drosophila melanogaster | FBgn0031145 | 1 retrocopy |