RetrogeneDB ID: | retro_dnov_1697 | ||
Retrocopy location | Organism: | Armadillo (Dasypus novemcinctus) | |
| Coordinates: | scaffold_268417:39..448(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CFL2 | ||
| Ensembl ID: | ENSDNOG00000017048 | ||
| Aliases: | None | ||
| Description: | cofilin 2 (muscle) [Source:HGNC Symbol;Acc:1875] |
| Percent Identity: | 72.86 % |
| Parental protein coverage: | 87.74 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | NDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDP-YTSFVKLLPLNDCRYAL |
| .D.KVRKS.TQEEI..RKKAVL..LS.D.RQI.VEEAKQILVG..GDT.EDP..TS.VKLLPLNDC.YAL | |
| Retrocopy | DDVKVRKS-TQEEITERKKAVLPYLSSDNRQISVEEAKQILVGETGDTIEDP<HTSSVKLLPLNDCWYAL |
| Parental | YDATYETKESKKEDLVFIFWAPES-APLKSKMIYASSKDAIKKKFTGK-HEWQVNGLND-IKDRSTLGEK |
| .DA.YE.K.SKKE.LVFIFWAPES.AP.KSKMIY..SKDAIKKKF.G...EWQV.G..D.....STLGEK | |
| Retrocopy | *DAIYEMKDSKKEVLVFIFWAPES>APFKSKMIYVGSKDAIKKKFKGI*YEWQVKGFDD>LENQSTLGEK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP012922_ascending_colon | 0 .00 RPM | 2 .14 RPM |
| SRP012922_cerebellum | 0 .00 RPM | 5 .36 RPM |
| SRP012922_heart | 0 .00 RPM | 12 .99 RPM |
| SRP012922_kidney | 0 .00 RPM | 0 .27 RPM |
| SRP012922_liver | 0 .00 RPM | 0 .00 RPM |
| SRP012922_lung | 0 .00 RPM | 0 .31 RPM |
| SRP012922_quadricep_muscle | 0 .00 RPM | 63 .52 RPM |
| SRP012922_spleen | 0 .00 RPM | 2 .17 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Dasypus novemcinctus | ENSDNOG00000000934 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017048 | 7 retrocopies |
retro_dnov_1072, retro_dnov_1379, retro_dnov_1697 , retro_dnov_2195, retro_dnov_2691, retro_dnov_715, retro_dnov_905,
|
| Erinaceus europaeus | ENSEEUG00000013155 | 4 retrocopies | |
| Echinops telfairi | ENSETEG00000006010 | 3 retrocopies | |
| Latimeria chalumnae | ENSLACG00000018011 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000000739 | 11 retrocopies | |
| Monodelphis domestica | ENSMODG00000012949 | 1 retrocopy | |
| Oryctolagus cuniculus | ENSOCUG00000009383 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004732 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000000391 | 2 retrocopies |