RetrogeneDB ID: | retro_ggor_821 | ||
Retrocopylocation | Organism: | Gorilla (Gorilla gorilla) | |
Coordinates: | 12:90123064..90123290(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAP | ||
Ensembl ID: | ENSGGOG00000013770 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 57.69 % |
Parental protein coverage: | 61.79 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKA-PKAR-IGDLDKKKYLVPSDLTVGQFYFLIRKRIH |
KFVYKEEHP.E..RSEGEKI..KY.....V......PK.R..GDLDKKKY...S.LTVGQF..LI.K..H | |
Retrocopy | KFVYKEEHPLEEYRSEGEKIQRKYSELAGVSGKAS<PKLR<MGDLDKKKYMMLSHLTVGQFHLLIWK*TH |
Parental | LRAEDALF |
L..E..L. | |
Retrocopy | LKLELILY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 124 .78 RPM |
SRP007412_cerebellum | 0 .00 RPM | 87 .82 RPM |
SRP007412_heart | 0 .00 RPM | 82 .55 RPM |
SRP007412_kidney | 0 .00 RPM | 189 .89 RPM |
SRP007412_liver | 0 .00 RPM | 136 .03 RPM |
SRP007412_testis | 0 .00 RPM | 130 .43 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000012299 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy |
retro_ggor_821 ,
|
Gorilla gorilla | ENSGGOG00000022360 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
Drosophila melanogaster | FBgn0052672 | 1 retrocopy |