RetrogeneDB ID: | retro_cjac_2851 | ||
Retrocopylocation | Organism: | Marmoset (Callithrix jacchus) | |
Coordinates: | 6:132668077..132668428(-) | ||
Located in intron of: | ENSCJAG00000012374 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | GABARAP | ||
Ensembl ID: | ENSCJAG00000016655 | ||
Aliases: | None | ||
Description: | GABA(A) receptor-associated protein [Source:HGNC Symbol;Acc:4067] |
Percent Identity: | 97.44 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
MKFVYKEEHPFEKR.SEGEKI.KKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLT.GQFYFLIRKRIHL | |
Retrocopy | MKFVYKEEHPFEKRCSEGEKIQKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTAGQFYFLIRKRIHL |
Parental | RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL | |
Retrocopy | RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP051959_colon | 0 .02 RPM | 11 .00 RPM |
SRP051959_heart | 0 .02 RPM | 17 .10 RPM |
SRP051959_kidney | 0 .02 RPM | 19 .44 RPM |
SRP051959_liver | 0 .02 RPM | 14 .06 RPM |
SRP051959_lung | 0 .03 RPM | 15 .26 RPM |
SRP051959_lymph_node | 0 .07 RPM | 10 .23 RPM |
SRP051959_skeletal_muscle | 0 .04 RPM | 28 .48 RPM |
SRP051959_spleen | 0 .06 RPM | 18 .57 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000004473 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000014253 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies |
retro_cjac_2851 , retro_cjac_3820,
|
Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
Drosophila melanogaster | FBgn0052672 | 1 retrocopy |