RetrogeneDB ID: | retro_sscr_163 | ||
Retrocopy location | Organism: | Pig (Sus scrofa) | |
| Coordinates: | 1:86159126..86159471(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSSSCG00000004396 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | GABARAP | ||
| Ensembl ID: | ENSSSCG00000017936 | ||
| Aliases: | None | ||
| Description: | Sus scrofa GABA(A) receptor-associated protein (GABARAP), mRNA. [Source:RefSeq mRNA;Acc:NM_001190288] |
| Percent Identity: | 80.87 % |
| Parental protein coverage: | 98.29 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKFVYKEEHPFEK...EG.KIRKK..D.V.VIVE.APK...GDLDKKKYLVPSDL..GQFYFLI.KRIHL | |
| Retrocopy | MKFVYKEEHPFEKGCTEGKKIRKKDSDWVLVIVEEAPKPQRGDLDKKKYLVPSDLIIGQFYFLIWKRIHL |
| Parental | RAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVY |
| .AEDALFFFVNNV.PPTSA.MGQL.QEHHE.DFFLYI.YSDESV. | |
| Retrocopy | QAEDALFFFVNNVLPPTSAMMGQLRQEHHEADFFLYITYSDESVW |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP014902_placenta | 0 .00 RPM | 0 .40 RPM |
| SRP014902_testis | 0 .00 RPM | 0 .57 RPM |
| SRP018288_heart | 0 .03 RPM | 0 .10 RPM |
| SRP018288_kidney | 0 .00 RPM | 0 .99 RPM |
| SRP018288_liver | 0 .00 RPM | 1 .28 RPM |
| SRP018288_lung | 0 .00 RPM | 0 .00 RPM |
| SRP018856_adipose | 0 .00 RPM | 0 .21 RPM |
| SRP035408_brain | 0 .00 RPM | 0 .00 RPM |
| SRP035408_liver | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014883 | 1 retrocopy | |
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000005229 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004652 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010473 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004388 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000002655 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy |
retro_sscr_163 ,
|
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |