RetrogeneDB ID: | retro_cint_25 | ||
Retrocopy location | Organism: | Vase tunicate (Ciona intestinalis) | |
| Coordinates: | 2:2847323..2847674(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSCING00000012473 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 56.41 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MKWQYKEEHTFDKRRTEGEKIRKKYPDRVPVIVEKAMKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
| MKWQ.K..HT...R..E..KI..KYP.R.PVIVEKA....I.D.DK.KYLVP.D..V.QF...IRKRI.L | |
| Retrocopy | MKWQFKVDHTYEHRCNESSKIITKYPSRIPVIVEKAEGSTIQDIDKRKYLVPADISVAQFMWIIRKRIDL |
| Parental | RPEEALFFFVNNVIPPTSTTMGQLYQEHHEEDFFLYIAYSDESVYGA |
| .PE.A.F.FV..V.P....TMG..Y.EH..ED.FLYIAYS.E...G. | |
| Retrocopy | SPEKAIFLFVDKVVPNSCSTMGAIYAEHKDEDGFLYIAYSGENTFGS |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| EST ID | Start | End | Identity | Match | Mis-match | Score |
|---|---|---|---|---|---|---|
| AV980484 | 2847320 | 2847440 | 97.5 | 113 | 3 | 110 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000014883 | 1 retrocopy | |
| Ciona intestinalis | ENSCING00000012473 | 1 retrocopy |
retro_cint_25 ,
|
| Callithrix jacchus | ENSCJAG00000016655 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000005229 | 1 retrocopy | |
| Echinops telfairi | ENSETEG00000004652 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000013770 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000000744 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000010545 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010473 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000018567 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000008049 | 2 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000006997 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000004388 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000007901 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000034115 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000017417 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000017936 | 1 retrocopy | |
| Drosophila melanogaster | FBgn0052672 | 1 retrocopy |