RetrogeneDB ID: | retro_meug_427 | ||
Retrocopylocation | Organism: | Wallaby (Macropus eugenii) | |
Coordinates: | Scaffold112939:6593..6913(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMEUG00000016022 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 87.16 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MRLPNILLTGTPGVGKTTLGKELASRTGLTYVNVGDLAQEGQLYDGFDEEYECPILDEDRVVDELENKMK |
MRLP.ILLTGTPGVGKTTLGKELASR.GLTYVNVGDLAQEGQL.DGFDEE.EC..LDEDRVVDELENKMK | |
Retrocopy | MRLPYILLTGTPGVGKTTLGKELASRRGLTYVNVGDLAQEGQLHDGFDEECECSVLDEDRVVDELENKMK |
Parental | EGGVIVDYHGC-DFFPERWFHIVFVLQTDNSVLYPRLEK |
.GGVIVD.HG..DFFPE.WFHIVFVLQTDN.VLY.RL.K | |
Retrocopy | -GGVIVDCHGM<DFFPE*WFHIVFVLQTDNLVLYTRLKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012471 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000036421 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000024524 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000015545 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016022 | 12 retrocopies | |
Myotis lucifugus | ENSMLUG00000028932 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000019421 | 14 retrocopies | |
Mustela putorius furo | ENSMPUG00000014588 | 1 retrocopy | |
Mus musculus | ENSMUSG00000078941 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004086 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000020970 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000027736 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000015527 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000016949 | 10 retrocopies | |
Rattus norvegicus | ENSRNOG00000039848 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017216 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000024448 | 2 retrocopies |