RetrogeneDB ID: | retro_pabe_3298 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 8:6745914..6746356(-) | ||
Located in intron of: | ENSPPYG00000018317 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000015527 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 84.56 % |
Parental protein coverage: | 86.05 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | SKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFP-ERWFHIVF |
SKS.LKYIN.GDLA.EEQLYDGYDEEY.CPILDEDRV.DELDNQMRE.GVIVDYHG..F.P.ERWFH.VF | |
Retrocopy | SKSELKYINMGDLA*EEQLYDGYDEEYNCPILDEDRVADELDNQMRECGVIVDYHG-*FLP>ERWFHTVF |
Parental | VLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWI |
VLRTD.N.LYE.LE.RGYN.KKL.DNI.CEIFQVLYEEATAS.KEE..HQLPSNKP.ELENNVDQILKWI | |
Retrocopy | VLRTDANILYEILEMRGYNKKKLKDNIHCEIFQVLYEEATASNKEEVAHQLPSNKPQELENNVDQILKWI |
Parental | EQWIKDHNS |
.QWIKDHNS | |
Retrocopy | QQWIKDHNS |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 18 .74 RPM |
SRP007412_cerebellum | 0 .24 RPM | 18 .73 RPM |
SRP007412_heart | 0 .03 RPM | 8 .76 RPM |
SRP007412_kidney | 0 .03 RPM | 14 .88 RPM |
SRP007412_liver | 0 .00 RPM | 8 .48 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4016 |
Pan troglodytes | retro_ptro_2726 |
Macaca mulatta | retro_mmul_2317 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000012471 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000036421 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000024524 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000015545 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016022 | 12 retrocopies | |
Myotis lucifugus | ENSMLUG00000028932 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000019421 | 14 retrocopies | |
Mustela putorius furo | ENSMPUG00000014588 | 1 retrocopy | |
Mus musculus | ENSMUSG00000078941 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000004086 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000020970 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000027736 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000015527 | 3 retrocopies |
retro_pabe_3298 , retro_pabe_483, retro_pabe_835,
|
Pan troglodytes | ENSPTRG00000016949 | 10 retrocopies | |
Rattus norvegicus | ENSRNOG00000039848 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000017216 | 2 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000024448 | 2 retrocopies |