RetrogeneDB ID: | retro_ptro_867 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 13:51225162..51225388(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SNRPG | ||
Ensembl ID: | ENSPTRG00000012029 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 73.68 % |
Parental protein coverage: | 98.68 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGIL-RGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIM |
MSKA....LK.FM.K.LSLKLNGGRHVQGIL.RGFDPFMNLV.DECVEMA..GQQ.N.G.VVI.GN..I. | |
Retrocopy | MSKAYLSMLKLFMGKTLSLKLNGGRHVQGIL>RGFDPFMNLVMDECVEMAAGGQQSNTGKVVI*GNGVIL |
Parental | LEALER |
LE.LE. | |
Retrocopy | LETLEQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .95 RPM |
SRP007412_cerebellum | 0 .00 RPM | 5 .84 RPM |
SRP007412_heart | 0 .00 RPM | 14 .17 RPM |
SRP007412_kidney | 0 .00 RPM | 16 .58 RPM |
SRP007412_liver | 0 .00 RPM | 15 .06 RPM |
SRP007412_testis | 0 .21 RPM | 29 .40 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1267 |
Pongo abelii | retro_pabe_1054 |