RetrogeneDB ID: | retro_ptro_967 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 14:49501253..49501474(-) | ||
| Located in intron of: | ENSPTRG00000023829 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | SNRPG | ||
| Ensembl ID: | ENSPTRG00000012029 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 85.33 % |
| Parental protein coverage: | 97.37 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMN-LVIDECVEMATSGQQNNIGMVVIRGNSIIM |
| MSKA.P..LKKFMDKKL.LKLNGGRHVQGIL.GFDPFMN.LVID.CVEMATSGQQNNIGMVV..GNS.IM | |
| Retrocopy | MSKAYPLDLKKFMDKKL*LKLNGGRHVQGILWGFDPFMN<LVIDKCVEMATSGQQNNIGMVVMQGNSTIM |
| Parental | LEALE |
| LE.LE | |
| Retrocopy | LEDLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .95 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 5 .84 RPM |
| SRP007412_heart | 0 .03 RPM | 14 .17 RPM |
| SRP007412_kidney | 0 .03 RPM | 16 .58 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .06 RPM |
| SRP007412_testis | 0 .11 RPM | 29 .40 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1413 |
| Pongo abelii | retro_pabe_1169 |
| Callithrix jacchus | retro_cjac_796 |