RetrogeneDB ID: | retro_rnor_2495 | ||
Retrocopylocation | Organism: | Rat (Rattus norvegicus) | |
Coordinates: | 7:5387949..5388356(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Srsf7 | ||
Ensembl ID: | ENSRNOG00000027360 | ||
Aliases: | Srsf7, Sfrs7 | ||
Description: | splicing factor, arginine/serine-rich 7 [Source:RefSeq peptide;Acc:NP_001034124] |
Percent Identity: | 67.14 % |
Parental protein coverage: | 58.4 % |
Number of stop codons detected: | 8 |
Number of frameshifts detected | 1 |
Parental | PFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSL |
PFDPNDRCY..GE.G.YAYD....SR.RR..S.SRSHS..R.R.Y..S.SRS.GRRSRSASP...R.VSL | |
Retrocopy | PFDPNDRCYMYGETGDYAYD*YQQSRQRRW-S*SRSHS*CRER*YYCSYSRS*GRRSRSASPQSPRVVSL |
Parental | RRSRSASLRRSRSGSIIGSRYFQSRSRSRSRSRSISRPRSSRSKSRSPSPKRSRS-PSGSPHRSASPERM |
....SAS.RR..SGSIIGSRYFQS.SRS.SRSR.IS..RSS.SK..SPSPKR..S.PS..PHRSAS.ER. | |
Retrocopy | --C*SASFRRYTSGSIIGSRYFQSHSRSKSRSRTIS*SRSS*SKYISPSPKRGYS<PSQGPHRSASTERI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP017611_brain | 0 .00 RPM | 38 .03 RPM |
SRP017611_kidney | 0 .00 RPM | 33 .57 RPM |
SRP017611_liver | 0 .00 RPM | 25 .55 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000015988 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000029620 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000007821 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000016459 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000009536 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000008669 | 1 retrocopy | |
Mus musculus | ENSMUSG00000024097 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000010169 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000000520 | 11 retrocopies | |
Rattus norvegicus | ENSRNOG00000005513 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000006380 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000027360 | 11 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000015970 | 1 retrocopy |