RetrogeneDB ID: | retro_btau_952 | ||
Retrocopylocation | Organism: | Cow (Bos taurus) | |
Coordinates: | 21:32090305..32090640(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARPP19 | ||
Ensembl ID: | ENSBTAG00000011022 | ||
Aliases: | ARPP19, ARPP-16, ARPP-19 | ||
Description: | cAMP-regulated phosphoprotein 19 [Source:UniProtKB/Swiss-Prot;Acc:Q28055] |
Percent Identity: | 90.43 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | MSAEVPEAASAEEQKEMEDKVTSPEKAEEAK-LKARYPHLGQKPGGSDFLRKRLQKGQKYFDSGDYNMAK |
MSAEVP.AASAEEQKEMEDKV.SPEKAEEAK.LKARYPHLGQ.PGGSDFL.KRL.KG.KYFDSGDYNMAK | |
Retrocopy | MSAEVPQAASAEEQKEMEDKVISPEKAEEAK>LKARYPHLGQNPGGSDFLSKRLHKG*KYFDSGDYNMAK |
Parental | A-KMKNKQLPTATPDKTEVTGDHI-PTPQDLPQRKPSLVASKLAG |
A.KMKNKQLPTATPDKTEVTGD.I.PTPQDLPQ.KPSLVASKLAG | |
Retrocopy | A<KMKNKQLPTATPDKTEVTGDYI<PTPQDLPQWKPSLVASKLAG |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
ERP005899_liver | 0 .00 RPM | 23 .86 RPM |
ERP005899_muscle | 0 .00 RPM | 20 .22 RPM |
SRP017611_brain | 0 .00 RPM | 122 .97 RPM |
SRP017611_kidney | 0 .00 RPM | 48 .78 RPM |
SRP017611_liver | 0 .00 RPM | 9 .74 RPM |
SRP030211_testis | 0 .00 RPM | 83 .42 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000011022 | 5 retrocopies | |
Canis familiaris | ENSCAFG00000032515 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000011228 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004474 | 9 retrocopies | |
Dipodomys ordii | ENSDORG00000011321 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015550 | 1 retrocopy | |
Homo sapiens | ENSG00000128989 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000025250 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000006551 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000015489 | 10 retrocopies | |
Otolemur garnettii | ENSOGAG00000013865 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000006487 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000042183 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000004618 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000003677 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000004804 | 1 retrocopy |