RetrogeneDB ID: | retro_cfam_535 | ||
Retrocopylocation | Organism: | Dog (Canis familiaris) | |
Coordinates: | 12:71241187..71241394(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDCD5 | ||
Ensembl ID: | ENSCAFG00000007555 | ||
Aliases: | None | ||
Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
Percent Identity: | 66.2 % |
Parental protein coverage: | 61.26 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | EMRNSILA-QVLDQSARARL-SNLALVKPEKT-KAVENYLIQMARYGQLSGKVSEQGLIEILEKVSQQTE |
EMR..I......DQSA...L.SNLALVKPEKT.KAVE.YL.QMARYG...G.VSE.GL.EIL.KVSQQ.. | |
Retrocopy | EMRDNIPT>HIQDQSAWGLL>SNLALVKPEKT>KAVEGYLTQMARYGHPTGNVSEHGLLEILQKVSQQRR |
Parental | K |
K | |
Retrocopy | K |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012049_cerebellum | 0 .00 RPM | 41 .37 RPM |
SRP017611_brain | 0 .00 RPM | 24 .85 RPM |
SRP017611_kidney | 0 .00 RPM | 24 .43 RPM |
SRP017611_liver | 0 .00 RPM | 9 .72 RPM |