RetrogeneDB ID: | retro_dnov_283 | ||
Retrocopylocation | Organism: | Armadillo (Dasypus novemcinctus) | |
Coordinates: | GeneScaffold_3260:33802..34040(+) | ||
Located in intron of: | ENSDNOG00000008453 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PDCD5 | ||
Ensembl ID: | ENSDNOG00000004010 | ||
Aliases: | None | ||
Description: | programmed cell death 5 [Source:HGNC Symbol;Acc:8764] |
Percent Identity: | 76.83 % |
Parental protein coverage: | 64. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | EELEALRKQRLAELQAKHGDPSDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPE-KTKAVEN |
EELEALRKQRLAELQ.K..DPSDAAQQEAKH.EA.MRNS.L.QVL..SA.ARLSN..LVKPE....AVEN | |
Retrocopy | EELEALRKQRLAELQVKPRDPSDAAQQEAKHWEAAMRNSTLGQVLQRSAWARLSN*PLVKPE<GKNAVEN |
Parental | YLIQM-ARYGQL |
YLIQ..AR.GQL | |
Retrocopy | YLIQT<ARSGQL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP012922_ascending_colon | 0 .00 RPM | 29 .17 RPM |
SRP012922_cerebellum | 0 .00 RPM | 33 .40 RPM |
SRP012922_heart | 0 .00 RPM | 39 .91 RPM |
SRP012922_kidney | 0 .00 RPM | 39 .43 RPM |
SRP012922_liver | 0 .15 RPM | 18 .58 RPM |
SRP012922_lung | 0 .00 RPM | 35 .13 RPM |
SRP012922_quadricep_muscle | 0 .00 RPM | 36 .35 RPM |
SRP012922_spleen | 0 .11 RPM | 31 .13 RPM |